PDB entry 2pqs

View 2pqs on RCSB PDB site
Description: Crystal Structure of the Bovine Lactadherin C2 Domain
Class: cell adhesion
Keywords: C2 domain, lactadherin, membrane binding, CELL ADHESION
Deposited on 2007-05-02, released 2007-08-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.235
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactadherin
    Species: Bos taurus [TaxId:9913]
    Gene: MFGE8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95114 (1-158)
      • expression tag (0)
    Domains in SCOPe 2.04: d2pqsa_
  • Chain 'B':
    Compound: Lactadherin
    Species: Bos taurus [TaxId:9913]
    Gene: MFGE8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95114 (1-158)
      • expression tag (0)
    Domains in SCOPe 2.04: d2pqsb_
  • Chain 'C':
    Compound: Lactadherin
    Species: Bos taurus [TaxId:9913]
    Gene: MFGE8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95114 (1-158)
      • expression tag (0)
    Domains in SCOPe 2.04: d2pqsc_
  • Chain 'D':
    Compound: Lactadherin
    Species: Bos taurus [TaxId:9913]
    Gene: MFGE8
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q95114 (1-158)
      • expression tag (0)
    Domains in SCOPe 2.04: d2pqsd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pqsA (A:)
    vcteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasew
    lqidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnm
    dnnshkknifetpfqarfvriqpvawhnritlrvellgc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pqsB (B:)
    vcteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasew
    lqidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnm
    dnnshkknifetpfqarfvriqpvawhnritlrvellgc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pqsC (C:)
    vcteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasew
    lqidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnm
    dnnshkknifetpfqarfvriqpvawhnritlrvellgc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pqsD (D:)
    vcteplglkdntipnkqitassyyktwglsafswfpyyarldnqgkfnawtaqtnsasew
    lqidlgsqkrvtgiitqgardfghiqyvaayrvaygddgvtwteykdpgaseskifpgnm
    dnnshkknifetpfqarfvriqpvawhnritlrvellgc