PDB entry 2pqq

View 2pqq on RCSB PDB site
Description: Structural Genomics, the crystal structure of the N-terminal domain of a transcriptional regulator from Streptomyces coelicolor A3(2)
Class: transcription
Keywords: APC7345, transcriptional regulator, Streptomyces coelicolor A3(2), structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, TRANSCRIPTION
Deposited on 2007-05-02, released 2007-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.232
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3571, SCH17.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XA42 (2-146)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (27)
      • modified residue (69)
      • modified residue (139)
      • cloning artifact (147-148)
    Domains in SCOPe 2.06: d2pqqa1, d2pqqa2, d2pqqa3
  • Chain 'B':
    Compound: Putative transcriptional regulator
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3571, SCH17.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XA42 (2-146)
      • modified residue (2)
      • modified residue (27)
      • modified residue (69)
      • modified residue (139)
      • cloning artifact (147-148)
    Domains in SCOPe 2.06: d2pqqb1, d2pqqb2
  • Chain 'C':
    Compound: Putative transcriptional regulator
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3571, SCH17.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XA42 (Start-146)
      • modified residue (27)
      • modified residue (69)
      • modified residue (139)
      • cloning artifact (147)
    Domains in SCOPe 2.06: d2pqqc1, d2pqqc2
  • Chain 'D':
    Compound: Putative transcriptional regulator
    Species: Streptomyces coelicolor [TaxId:100226]
    Gene: SCO3571, SCH17.05
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XA42 (Start-146)
      • modified residue (27)
      • modified residue (69)
      • modified residue (139)
      • cloning artifact (147-148)
    Domains in SCOPe 2.06: d2pqqd1, d2pqqd2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pqqA (A:)
    ghmddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklh
    rtspdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpe
    vatallravarrlrktndamsdlvfsdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqqA (A:)
    ghmddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklh
    rtspdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpe
    vatallravarrlrktndamlvfsdgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pqqB (B:)
    ghmddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklh
    rtspdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpe
    vatallravarrlrktndamsdlvfsdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqqB (B:)
    mddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrt
    spdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpeva
    tallravarrlrktndamsdsdgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pqqC (C:)
    ghmddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklh
    rtspdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpe
    vatallravarrlrktndamsdlvfsdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqqC (C:)
    ddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrts
    pdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpevat
    allravarrlrktndamsdg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pqqD (D:)
    ghmddvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklh
    rtspdgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpe
    vatallravarrlrktndamsdlvfsdgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pqqD (D:)
    dvlrrnplfaalddeqsaelrasmsevtlargdtlfhegdpgdrlyvvtegkvklhrtsp
    dgrenmlavvgpseligelslfdpgprtatgtaltevkllalghgdlqpwlnvrpevata
    llravarrlrktndamlvfsdgs