PDB entry 2pq3

View 2pq3 on RCSB PDB site
Description: N-Terminal Calmodulin Zn-Trapped Intermediate
Class: metal binding protein
Keywords: calmodulin, helix-turn-helix, ef-hand, n-terminal calmodulin, cam, n-cam, metal binding protein
Deposited on 2007-05-01, released 2007-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.143
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Calm1, Calm, Cam, Cam1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2pq3a_
  • Heterogens: CAC, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2pq3A (A:)
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkm

    Sequence, based on observed residues (ATOM records): (download) 
    >2pq3A (A:)
qlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngt
idfpefltmmarkm