PDB entry 2ppp

View 2ppp on RCSB PDB site
Description: Crystal structure of E60Q mutant of FKBP12
Class: lyase
Keywords: high resolution protein structure, lyase
Deposited on 2007-04-30, released 2008-09-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 0.94 Å
R-factor: 0.203
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: FK506-binding protein 1A
  Species: HOMO SAPIENS
  Gene: FKBP1A, FKBP1, FKBP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
    • engineered (59)
  Domains in SCOPe 2.02: d2pppa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pppA (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwq
  egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle