PDB entry 2ppi

View 2ppi on RCSB PDB site
Description: Structure of the BTB (Tramtrack and Bric a brac) domain of human Gigaxonin
Class: structural protein
Keywords: BTB domain, protein degradation, Structural Genomics, Structural Genomics Consortium, SGC, STRUCTURAL PROTEIN
Deposited on 2007-04-30, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gigaxonin
    Species: Homo sapiens [TaxId:9606]
    Gene: GAN, GAN1, KLHL16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H2C0 (23-End)
      • cloning artifact (18-22)
    Domains in SCOPe 2.07: d2ppia1, d2ppia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ppiA (A:)
    mhhhhhhssgvdlgtenlyfqsmavsdpqhaarllralssfreesrfcdahlvldgeeip
    vqknilaaaspyirtklnynppkddgstykielegisvmvmreildyifsgqirlnedti
    qdvvqaadlllltdlktlccefle
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppiA (A:)
    yfqsmavsdpqhaarllralssfrerfcdahlvldgeeipvqknilaaaspyirtklnyn
    pstykielegisvmvmreildyifsgqirlnedtiqdvvqaadlllltdlktlccefl