PDB entry 2ppf

View 2ppf on RCSB PDB site
Description: Reduced mutant D98N of AfNiR exposed to nitric oxide
Class: Oxidoreductase
Keywords: nitrite reductase, D98N, nitric oxide, denitrification, bacteria, Oxidoreductase
Deposited on 2007-04-28, released 2008-01-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.151
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-End)
      • engineered (94)
    Domains in SCOPe 2.06: d2ppfa1, d2ppfa2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-336)
      • engineered (94)
    Domains in SCOPe 2.06: d2ppfb1, d2ppfb2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (0-End)
      • engineered (94)
    Domains in SCOPe 2.06: d2ppfc1, d2ppfc2
  • Heterogens: CU1, CU, ACT, NO, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ppfA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgtiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppfA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ppfB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgtiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppfB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ppfC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgtiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppfC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhninfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg