PDB entry 2ppd

View 2ppd on RCSB PDB site
Description: Oxidized H145A mutant of AfNiR bound to nitric oxide
Class: oxidoreductase
Keywords: H145A, nitrite reductase, nitric oxide, denitrification, bacteria, OXIDOREDUCTASE
Deposited on 2007-04-28, released 2008-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (147)
    Domains in SCOPe 2.07: d2ppda1, d2ppda2
  • Chain 'B':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501 (Start-342)
      • engineered (147)
    Domains in SCOPe 2.07: d2ppdb1, d2ppdb2
  • Chain 'C':
    Compound: Copper-containing nitrite reductase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: nirK, nir
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38501
      • engineered (147)
    Domains in SCOPe 2.07: d2ppdc1, d2ppdc2
  • Heterogens: CU1, CU, ACT, NO, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ppdA (A:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppdA (A:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ppdB (B:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppdB (B:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ppdC (C:)
    qgavrkataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagt
    evhamafngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpg
    ektilrfkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyy
    vgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaav
    gekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqq
    pgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlapsgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ppdC (C:)
    ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
    fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
    fkatkpgvfvyhcappgmvpwavvsgmngaimvlpreglhdgkgkaltydkiyyvgeqdf
    yvprdengkykkyeapgdayedtvkvmrtltpthvvfngavgaltgdkamtaavgekvli
    vhsqanrdtrphligghgdyvwatgkfntppdvdqetwfipggaagaafytfqqpgiyay
    vnhnlieafelgaaahfkvtgewnddlmtsvlapsg