PDB entry 2pog

View 2pog on RCSB PDB site
Description: Benzopyrans as Selective Estrogen Receptor b Agonists (SERBAs). Part 2: Structure Activity Relationship Studies on the Benzopyran Scaffold.
Class: lipid binding protein
Keywords: nuclear receptor, ligand-binding, LIPID BINDING PROTEIN
Deposited on 2007-04-26, released 2007-09-11
The last revision prior to the SCOP 1.75 freeze date was dated 2007-09-11, with a file datestamp of 2007-09-07.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.235
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (77)
      • engineered (113)
    Domains in SCOP 1.75: d2poga1
  • Chain 'B':
    Compound: Estrogen receptor
    Species: HOMO SAPIENS
    Gene: ESR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03372
      • engineered (77)
      • engineered (113)
  • Heterogens: WST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pogA (A:)
    nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
    vpgfvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmve
    ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
    dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvplydlllem
    ldahrlha
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pogA (A:)
    lalsltadqmvsalldaeppilyseyasmmglltnladrelvhminwakrvpgfvdltlh
    dqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifdmllatss
    rfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtlihlmaka
    gltlqqqhqrlaqlllilshirhmsnkgmehlysmkvplydlllemldahrlh
    

  • Chain 'B':
    No sequence available.