PDB entry 2pob

View 2pob on RCSB PDB site
Description: PPARgamma Ligand binding domain complexed with a farglitazar analogue gw4709
Class: Gene Regulation
Keywords: PPARG, Nuclear receptor,PPAR, Gene Regulation
Deposited on 2007-04-26, released 2008-03-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2poba_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2pobb_
  • Heterogens: GW4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pobA (A:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pobA (A:)
    esadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkikkevair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    tdmslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pobB (B:)
    pesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfk
    hitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvhei
    iytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdla
    ifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqi
    vtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pobB (B:)
    pesadlralakhlydsyiksfpltkakarailtgspfviydmnslmmgqskevairifqg
    cqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvliseg
    qgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvk
    piediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetlhp
    llqeiyk