PDB entry 2po2

View 2po2 on RCSB PDB site
Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with CDP
Class: hydrolase/hydrolase
Keywords: RNase PH, hydrolase/hydrolase COMPLEX
Deposited on 2007-04-25, released 2008-03-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.186
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 1
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: Rrp41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2po2a1, d2po2a2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 2
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: Rrp42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2po2b1, d2po2b2
  • Heterogens: CDP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2po2A (A:)
    mmekpeglklidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygpr
    elhpkhlqrpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfpr
    taidvfievlqadagtrvagitaaslaladagipmrdlvaacaagkiegeivldlnkeed
    nygeadvpvaimplknditllqmdgyltkdefieavklaikgakavyqkqrealkekylk
    iaqevegse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2po2A (A:)
    klidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygprelhpkhlq
    rpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfprtaidvfie
    vlqadagtrvagitaaslaladagipmrdlvaacaagkiegeivldlnkeednygeadvp
    vaimplknditllqmdgyltkdefieavklaikgakavyqkqrealkekylkiaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2po2B (B:)
    gshmsdneivagimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgst
    qvlvgiktslgepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgires
    kalnlekmvivpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetge
    vetldeteplpvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqks
    eggafkleevmyavetafkkaeeirklileavekakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2po2B (B:)
    agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
    gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
    vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl
    pvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqkseggafkleev
    myavetafkkaeeirklileavekakq