PDB entry 2pnz

View 2pnz on RCSB PDB site
Description: Crystal structure of the P. abyssi exosome RNase PH ring complexed with UDP and GMP
Class: hydrolase/hydrolase
Keywords: RNase PH, hydrolase/hydrolase COMPLEX
Deposited on 2007-04-25, released 2008-03-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.191
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 1
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: Rrp41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2pnza1, d2pnza2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 2
    Species: Pyrococcus abyssi [TaxId:29292]
    Gene: Rrp42
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2pnzb1, d2pnzb2
  • Heterogens: UDP, 5GP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pnzA (A:)
    mmekpeglklidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygpr
    elhpkhlqrpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfpr
    taidvfievlqadagtrvagitaaslaladagipmrdlvaacaagkiegeivldlnkeed
    nygeadvpvaimplknditllqmdgyltkdefieavklaikgakavyqkqrealkekylk
    iaqevegse
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnzA (A:)
    klidengrridgrkkyelrpikmevgvlknangsayiewgknkiiaavygprelhpkhlq
    rpdrailrvrynmapfsveerkkpgpdrrsieiskvikgalepalilemfprtaidvfie
    vlqadagtrvagitaaslaladagipmrdlvaacaagkiegeivldlnkeednygeadvp
    vaimplknditllqmdgyltkdefieavklaikgakavyqkqrealkekylkiaqe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pnzB (B:)
    gshmsdneivagimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgst
    qvlvgiktslgepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgires
    kalnlekmvivpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetge
    vetldeteplpvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqks
    eggafkleevmyavetafkkaeeirklileavekakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pnzB (B:)
    agimrdhiinllkegkriddrgfedyrpieievgviekaegsalvklgstqvlvgiktsl
    gepfpdtpnmgvmttnvelvplasptfepgppderaielarvidrgireskalnlekmvi
    vpgkivrvvfidvhvldhdgnlmdaigiaaiaallnarvpkvryneetgevetldetepl
    pvekipvpvtfakignilvvdpsldeelvmdgkitittdetghisavqkseggafkleev
    myavetafkkaeeirklileavekakq