PDB entry 2pnb

View 2pnb on RCSB PDB site
Description: structure of an sh2 domain of the p85 alpha subunit of phosphatidylinositol-3-oh kinase
Deposited on 1992-06-30, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2pnb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2pnb_ (-)
  lqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnklikifhrd
  gkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky