PDB entry 2pna

View 2pna on RCSB PDB site
Description: structure of an sh2 domain of the p85 alpha subunit of phosphatidylinositol-3-oh kinase
Deposited on 1992-06-30, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2pna__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pna_ (-)
    lqdaewywgdisreevneklrdtadgtflvrdastkmhgdytltlrkggnnklikifhrd
    gkygfsdpltfnsvvelinhyrneslaqynpkldvkllypvsky