PDB entry 2pmt

View 2pmt on RCSB PDB site
Description: glutathione transferase from proteus mirabilis
Deposited on 1998-04-28, released 1999-04-27
The last revision prior to the SCOP 1.61 freeze date was dated 1999-04-27, with a file datestamp of 1999-04-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.2086
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmtA (A:)
    mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
    diltegvaivqyladlkpdrnliappkaleryhqiewlnflasevhkgysplfssdtpes
    ylpvvknklkskfvyindvlskqkcvcgdhftvadaylftlsqwaphvaldltdlshlqd
    ylariaqrpnvhsalvtegli
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmtB (B:)
    mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
    diltegvaivqyladlkpdrnliappkaleryhqiewlnflasevhkgysplfssdtpes
    ylpvvknklkskfvyindvlskqkcvcgdhftvadaylftlsqwaphvaldltdlshlqd
    ylariaqrpnvhsalvtegli
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmtC (C:)
    mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
    diltegvaivqyladlkpdrnliappkaleryhqiewlnflasevhkgysplfssdtpes
    ylpvvknklkskfvyindvlskqkcvcgdhftvadaylftlsqwaphvaldltdlshlqd
    ylariaqrpnvhsalvtegli
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pmtD (D:)
    mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
    diltegvaivqyladlkpdrnliappkaleryhqiewlnflasevhkgysplfssdtpes
    ylpvvknklkskfvyindvlskqkcvcgdhftvadaylftlsqwaphvaldltdlshlqd
    ylariaqrpnvhsalvtegli