PDB entry 2pmq

View 2pmq on RCSB PDB site
Description: Crystal structure of a mandelate racemase/muconate lactonizing enzyme from Roseovarius sp. HTCC2601
Class: isomerase
Keywords: Structural genomics, Isomerase, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2007-04-23, released 2007-05-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.167
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius sp. [TaxId:314265]
    Gene: R2601_01638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0FPQ4 (3-368)
      • modified residue (90)
      • modified residue (141)
      • modified residue (218)
      • modified residue (241)
      • modified residue (265)
      • modified residue (276)
      • modified residue (317)
      • cloning artifact (369)
    Domains in SCOPe 2.05: d2pmqa1, d2pmqa2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius sp. [TaxId:314265]
    Gene: R2601_01638
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0FPQ4 (3-368)
      • modified residue (90)
      • modified residue (141)
      • modified residue (218)
      • modified residue (241)
      • modified residue (265)
      • modified residue (276)
      • modified residue (317)
      • cloning artifact (369-376)
    Domains in SCOPe 2.05: d2pmqb1, d2pmqb2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pmqA (A:)
    mslkiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyae
    ahaggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvp
    vhellggaltdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairk
    vweavrgtgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhal
    ymdedgtslntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggd
    ivsaacthiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidpe
    rfgpplfsaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmqA (A:)
    kiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeaha
    ggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhe
    llggaltdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvwe
    avrgtgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymd
    edgtslntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivs
    aacthiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfg
    pplfsae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pmqB (B:)
    mslkiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyae
    ahaggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvp
    vhellggaltdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairk
    vweavrgtgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhal
    ymdedgtslntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggd
    ivsaacthiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidpe
    rfgpplfsaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pmqB (B:)
    kiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeaha
    ggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhe
    llggaltdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvwe
    avrgtgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymd
    edgtslntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivs
    aacthiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfg
    pplfsaeghhhhhh