PDB entry 2ply

View 2ply on RCSB PDB site
Description: Structure of the mRNA binding fragment of elongation factor SelB in complex with SECIS RNA.
Class: translation/RNA
Keywords: protein-rna, complex, rna, winged helix, selb, SECIS, translation/RNA COMPLEX
Deposited on 2007-04-20, released 2007-11-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: selB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46455
      • engineered (158-159)
    Domains in SCOPe 2.05: d2plya1, d2plya2, d2plya3, d2plya4
  • Chain 'B':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Gene: selB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46455
      • engineered (158-159)
  • Chain 'C':
    Compound: RNA (5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp*gp*up*cp*up*gp*gp*cp*ap*ap*cp*gp*cp*c)-3')
    Species: synthetic, synthetic
  • Chain 'E':
    Compound: RNA (5'-r(*gp*gp*cp*gp*up*up*gp*cp*cp*gp*gp*up*cp*up*gp*gp*cp*ap*ap*cp*gp*cp*c)-3')
    Species: synthetic, synthetic
  • Heterogens: MG, CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2plyA (A:)
    gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
    teryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlq
    laantvalagftpsfsetqkkllkdledkyrvsrwqppwvkevagsfnldpseleellhy
    lvregvlvkindefywhrqalgeareviknlastgpfglaeardalgssrkyvlplleyl
    dqvkftrrvgdkrvvvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2plyA (A:)
    egldvtllrvdlyaisteryqawwqavtraleefhsryplrpglareelrsryfsrlpar
    vyqalleewsregrlqlaantvalagftpsfsetqkkllkdledkyrvsrwqppwvkeva
    gsfnldpseleellhylvregvlvkindefywhrqalgeareviknlastgpfglaeard
    algssrkyvlplleyldqvkftrrvgdkrvvv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.