PDB entry 2pln

View 2pln on RCSB PDB site
Description: Crystal structure analysis of HP1043, an orphan resonse regulator of h. pylori
Class: signaling protein
Keywords: hp1043, signaling protein
Deposited on 2007-04-20, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.208
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Response regulator
    Species: Helicobacter pylori [TaxId:210]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O25684 (18-End)
      • expression tag (14-17)
      • modified residue (18)
      • modified residue (43)
      • modified residue (57)
      • modified residue (66)
    Domains in SCOPe 2.07: d2plna1, d2plna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2plnA (A:)
    mrgshhhhhhgslvprgsmrvllieknsvlggeiekglnvkgfmadvtesledgeylmdi
    rnydlvmvsdknalsfvsrikekhssivvlvssdnptseeevhafeqgaddyiakpyrsi
    kalvariearlrfwgsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2plnA (A:)
    prgsmrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknal
    sfvsrikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlr