PDB entry 2pl3

View 2pl3 on RCSB PDB site
Description: Human DEAD-box RNA helicase DDX10, DEAD domain in complex with ADP
Class: hydrolase
Keywords: RNA, helicase, dead, structural genomics, structural genomics consortium, sgc, hydrolase
Deposited on 2007-04-19, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase DDX10
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX10
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13206 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d2pl3a1, d2pl3a2
  • Heterogens: MG, ADP, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pl3A (A:)
    smqveresisrlmqnyekinvneitrfsdfplskktlkglqeaqyrlvteiqkqtiglal
    qgkdvlgaaktgsgktlaflvpvlealyrlqwtstdglgvliisptrelayqtfevlrkv
    gknhdfsagliiggkdlkheaerinninilvctpgrllqhmdetvsfhatdlqmlvldea
    drildmgfadtmnavienlpkkrqtllfsatqtksvkdlarlslknpeyvwvheka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pl3A (A:)
    smqveresisrlmqnyekinvneitrfsdfplskktlkglqeaqyrlvteiqkqtiglal
    qgkdvlgaaktgsgktlaflvpvlealyrlqwtstdglgvliisptrelayqtfevlrkv
    gknhdfsagliigglkheaerinninilvctpgrllqhmdetvsfhatdlqmlvldeadr
    ildmgfadtmnavienlpkkrqtllfsatqtksvkdlarlslknpeyvwvhe