PDB entry 2pk6
View 2pk6 on RCSB PDB site
Description: Crystal Structure of HIV-1 Protease (Q7K, L33I, L63I) in Complex with KNI-10033
Class: Viral Protein
Keywords: protease complex
Deposited on
2007-04-17, released
2007-05-08
The last revision prior to the SCOP 1.73 freeze date was dated
2007-08-14, with a file datestamp of
2007-08-10.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.207
AEROSPACI score: 0.63
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protease
Species: Human immunodeficiency virus type 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
Domains in SCOP 1.73: d2pk6a1 - Chain 'B':
Compound: Protease
Species: Human immunodeficiency virus type 1
Gene: gag-pol
Database cross-references and differences (RAF-indexed):
- Uniprot P03367 (0-98)
- engineered (6)
- engineered (32)
- engineered (62)
Domains in SCOP 1.73: d2pk6b1 - Heterogens: O33, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2pk6A (A:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2pk6B (B:)
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf