PDB entry 2pjq

View 2pjq on RCSB PDB site
Description: Crystal structure of Q88U62_LACPL from Lactobacillus plantarum. Northeast Structural Genomics target LpR71
Class: structural genomics, unknown function
Keywords: LpR71, NESG, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2007-04-16, released 2007-05-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.236
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein lp_2664
    Species: Lactobacillus plantarum WCFS1 [TaxId:220668]
    Gene: lp_2664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88U62 (5-End)
      • modified residue (5)
      • modified residue (104)
      • modified residue (162)
      • modified residue (189)
      • modified residue (205)
    Domains in SCOPe 2.01: d2pjqa1
  • Chain 'B':
    Compound: Uncharacterized protein lp_2664
    Species: Lactobacillus plantarum WCFS1 [TaxId:220668]
    Gene: lp_2664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88U62 (5-End)
      • modified residue (5)
      • modified residue (70)
      • modified residue (104)
      • modified residue (162)
      • modified residue (189)
      • modified residue (205)
    Domains in SCOPe 2.01: d2pjqb_
  • Chain 'C':
    Compound: Uncharacterized protein lp_2664
    Species: Lactobacillus plantarum WCFS1 [TaxId:220668]
    Gene: lp_2664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88U62 (5-End)
      • modified residue (5)
      • modified residue (70)
      • modified residue (104)
      • modified residue (162)
      • modified residue (189)
      • modified residue (205)
    Domains in SCOPe 2.01: d2pjqc_
  • Chain 'D':
    Compound: Uncharacterized protein lp_2664
    Species: Lactobacillus plantarum WCFS1 [TaxId:220668]
    Gene: lp_2664
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88U62 (5-End)
      • modified residue (5)
      • modified residue (104)
      • modified residue (162)
      • modified residue (189)
      • modified residue (205)
    Domains in SCOPe 2.01: d2pjqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pjqA (A:)
    magdpmitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaa
    wlhdviddklmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklsle
    gqvvqdadrldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfy
    eklfklaalmntdtakalaahrtavmhefvdqfkaewtaddkalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjqA (A:)
    mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv
    idahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvqdadrldaig
    aigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaalmntdt
    akalaahrtavmhefvdqfkaewtad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pjqB (B:)
    magdpmitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaa
    wlhdviddklmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklsle
    gqvvqdadrldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfy
    eklfklaalmntdtakalaahrtavmhefvdqfkaewtaddkalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjqB (B:)
    mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv
    ilmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvqdad
    rldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaa
    lmntdtakalaahrtavmhefvdqfkaewtad
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pjqC (C:)
    magdpmitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaa
    wlhdviddklmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklsle
    gqvvqdadrldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfy
    eklfklaalmntdtakalaahrtavmhefvdqfkaewtaddkalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjqC (C:)
    mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv
    idmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvqdad
    rldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaa
    lmntdtakalaahrtavmhefvdqfkaewtad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pjqD (D:)
    magdpmitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaa
    wlhdviddklmanpakahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklsle
    gqvvqdadrldaigaigiaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfy
    eklfklaalmntdtakalaahrtavmhefvdqfkaewtaddkalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pjqD (D:)
    mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdv
    idahqdlivqlnaqnvtqtaifaiidhmsfsksfngpqklslegqvvqdadrldaigaig
    iaralyysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaalmntdtaka
    laahrtavmhefvdqfkaewtad