PDB entry 2pi6

View 2pi6 on RCSB PDB site
Description: Crystal structure of the sheep signalling glycoprotein (SPS-40) complex with 2-methyl-2-4-pentanediol at 1.65A resolution reveals specific binding characteristics of SPS-40
Class: signaling protein
Keywords: Complex, SIGNALING PROTEIN
Deposited on 2007-04-13, released 2007-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.168
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chitinase-3-like protein 1
    Species: Ovis aries [TaxId:9940]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6TMG6 (0-360)
      • see remark 999 (35)
      • see remark 999 (86)
      • see remark 999 (202)
      • see remark 999 (260)
      • see remark 999 (360)
    Domains in SCOPe 2.07: d2pi6a1, d2pi6a2
  • Heterogens: MPD, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pi6A (A:)
    yklicyytswsqyregdgscfpdaidpflcthviytfanisnneidtwewndvtlydtln
    tlknrnpklktllsvggwnfgperfskiasktqsrrtfiksvppflrthgfdgldlawly
    pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
    slltydfhgawrqtvghhsplfrgnedassrfsnadyavsymlrlgapanklvmgiptfg
    rsftlassktdvgapvsgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyatkg
    nqwvayddqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlae
    a