PDB entry 2phl

View 2phl on RCSB PDB site
Description: the structure of phaseolin at 2.2 angstroms resolution: implications for a common vicilin(slash)legumin structure and the genetic engineering of seed storage proteins
Class: plant seed storage protein(vicilin)
Keywords: plant seed storage protein(vicilin)
Deposited on 1994-07-07, released 1994-09-30
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.178
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phaseolin
    Species: Phaseolus vulgaris
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2phla1, d2phla2
  • Chain 'B':
    Compound: phaseolin
    Species: Phaseolus vulgaris
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2phlb1, d2phlb2
  • Chain 'C':
    Compound: phaseolin
    Species: Phaseolus vulgaris
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2phlc1, d2phlc2
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2phlA (A:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phlA (A:)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhakssntignefgnltertdnslnvlissiemeegalfvphyysk
    aivilvvnegeahvelvgpkgetleyesyraelskddvfvipaaypvaikatsnvnftgf
    ginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2phlB (B:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phlB (B:)
    dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
    daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
    iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
    vivnidseqikelskhakssntignefgnltertdnslnvlissiemeegalfvphyysk
    aivilvvnegeahvelvgpkgetleyesyraelskddvfvipaaypvaikatsnvnftgf
    ginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2phlC (C:)
    tslreeeesqdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrsk
    petlllpqqadaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifyl
    vnpdpkedlriiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrv
    lfeeegqqegvivnidseqikelskhaksssrkslskqdntignefgnltertdnslnvl
    issiemeegalfvphyyskaivilvvnegeahvelvgpkgnketleyesyraelskddvf
    vipaaypvaikatsnvnftgfginannnnrnllagktdnvissigraldgkdvlgltfsg
    sgdevmklinkqsgsyfvdahhhqqeqqkgrkgafvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2phlC (C:)
    qdnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqq
    adaelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedl
    riiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqe
    gvivnidseqikelskhakssntignefgnltertdnslnvlissiemeegalfvphyys
    kaivilvvnegeahvelvgpkgetleyesyraelskddvfvipaaypvaikatsnvnftg
    fginannnnrnllagktdnvissigraldgkdvlgltfsgsgdevmklinkqsgsyfvda
    h