PDB entry 2phk

View 2phk on RCSB PDB site
Description: the crystal structure of a phosphorylase kinase peptide substrate complex: kinase substrate recognition
Class: complex (transferase/peptide)
Keywords: catalytic mechanism, dimerization, phosphorylase kinase, reversible phosphorylisation, substrate recognition, complex (transferase/peptide)
Deposited on 1998-06-18, released 1999-01-13
The last revision prior to the SCOP 1.75 freeze date was dated 1999-01-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.253
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphorylase kinase
    Species: Oryctolagus cuniculus
    Gene: PHKG
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2phka_
  • Chain 'B':
    Compound: mc-peptide
  • Heterogens: MN, ATP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2phkA (A:)
    gfyenyepkeilgrgvssvvrrcihkptckeyavkiidvtgggsfsaeevqelreatlke
    vdilrkvsghpniiqlkdtyetntffflvfdlmkkgelfdyltekvtlseketrkimral
    levicalhklnivhrdlkpenilldddmnikltdfgfscqldpgeklrevcgtpsylape
    iiecsmndnhpgygkevdmwstgvimytllagsppfwhrkqmlmlrmimsgnyqfgspew
    ddysdtvkdlvsrflvvqpqkrytaeealahpffqqy
    

  • Chain 'B':
    No sequence available.