PDB entry 2pgw

View 2pgw on RCSB PDB site
Description: Crystal structure of a putative muconate cycloisomerase from Sinorhizobium meliloti 1021
Class: isomerase
Keywords: Enolase superfamily, Muconate cycloisomerase, Octamer, Small molecule metabolism, PSI-II, NYSGXRC, 9387a, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, ISOMERASE
Deposited on 2007-04-10, released 2007-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwa1, d2pgwa2
  • Chain 'B':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwb1, d2pgwb2
  • Chain 'C':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-375)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
      • cloning artifact (376-377)
    Domains in SCOPe 2.07: d2pgwc1, d2pgwc2, d2pgwc3
  • Chain 'D':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwd1, d2pgwd2
  • Chain 'E':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwe1, d2pgwe2
  • Chain 'F':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwf1, d2pgwf2
  • Chain 'G':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwg1, d2pgwg2
  • Chain 'H':
    Compound: Muconate cycloisomerase
    Species: Sinorhizobium meliloti [TaxId:266834]
    Gene: RA0797, SMa1461
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92YR6 (3-End)
      • modified residue (98)
      • modified residue (110)
      • modified residue (112)
      • modified residue (208)
      • modified residue (232)
      • modified residue (266)
      • modified residue (280-281)
      • modified residue (326)
    Domains in SCOPe 2.07: d2pgwh1, d2pgwh2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pgwA (A:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwA (A:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pgwB (B:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwB (B:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pgwC (C:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwC (C:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaasreg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pgwD (D:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwD (D:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaas
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pgwE (E:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwE (E:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaas
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pgwF (F:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwF (F:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaas
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pgwG (G:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwG (G:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaas
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pgwH (H:)
    mslvkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgt
    aailyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgkl
    aglpvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldlei
    taavrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekv
    gipivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihss
    fttgittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfql
    aedlvaegegryaasreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgwH (H:)
    vkisnvrvrplvlplkqpyhwsygiresfavnlieieaddgtvgigectvapdqtgtaai
    lyrlakhlvghsphdvapliarifhqeylghganimraanqifsgidmamwdlqgklagl
    pvhqllggahrkavgyfyflqgetaeelardaavghaqgervfylkvgrgekldleitaa
    vrgeigdarlrldanegwsvhdainmcrklekydiefieqptvswsipamahvrekvgip
    ivadqaaftlydvyeicrqraadmicigpreiggiqpmmkaaavaeaaglkicihssftt
    gittcaehhiglaipnlddgnqimwqlvqedivsspdltpkngwldafrkpglgfqlaed
    lvaegegryaas