PDB entry 2pgv

View 2pgv on RCSB PDB site
Description: gtb c209a
Class: transferase
Keywords: Glycosyltransferase, ABO(H), blood group, H-antigen, GTB, Rossmann fold, C209A, TRANSFERASE
Deposited on 2007-04-10, released 2007-07-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.187
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycoprotein-fucosylgalactoside alpha-galactosyltransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: ABO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16442 (1-End)
      • variant (113)
      • engineered (146)
      • variant (172)
      • variant (203)
      • variant (205)
    Domains in SCOPe 2.06: d2pgva_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pgvA (A:)
    mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
    ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
    dvsmrrmemisdfcerrflsevdylvavdvdmefrdhvgveiltplfgtlhpsfygssre
    aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
    eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpknhqavrnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgvA (A:)
    vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
    kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgrmemisd
    fcerrflsevdylvavdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqa
    yipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhk
    ptkvlspeylwdqqllgwpavlrklrftavp