PDB entry 2pgt

View 2pgt on RCSB PDB site
Description:
Deposited on 1997-02-17, released 1997-09-04
The last revision prior to the SCOP 1.69 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2pgta1, d2pgta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d2pgtb1, d2pgtb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pgtA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pgtB (B:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pgtB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyvsliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq