PDB entry 2pg4

View 2pg4 on RCSB PDB site
Description: Crystal structure of a putative dna binding protein (ape_0880a) from aeropyrum pernix k1 at 2.21 A resolution
Class: DNA binding protein
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, dna binding protein
Deposited on 2007-04-06, released 2007-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: 0.201
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: NP_147569.1, APE0880.1, APES039, APE_0880a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YDN4 (1-End)
      • modified residue (1)
      • modified residue (48)
    Domains in SCOPe 2.05: d2pg4a1
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Aeropyrum pernix [TaxId:272557]
    Gene: NP_147569.1, APE0880.1, APES039, APE_0880a
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YDN4
      • modified residue (48)
    Domains in SCOPe 2.05: d2pg4b_
  • Heterogens: CL, CIT, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pg4A (A:)
    gmddetlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliragl
    vkeetlsyrvktlkltekgrrlaeclekcrdvlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg4A (A:)
    mddetlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliraglv
    keetlsyrvktlkltekgrrlaeclekcrdvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pg4B (B:)
    gmddetlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliragl
    vkeetlsyrvktlkltekgrrlaeclekcrdvlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg4B (B:)
    detlrlqfghlirilptllefekkgyepslaeivkasgvsektffmglkdrliraglvke
    etlsyrvktlkltekgrrlaeclekcrdvlg