PDB entry 2pg0

View 2pg0 on RCSB PDB site
Description: Crystal structure of acyl-CoA dehydrogenase from Geobacillus kaustophilus
Class: oxidoreductase
Keywords: GK1316, Acyl-CoA dehydrogenase, Geobacillus kaustophilus HTA426, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, OXIDOREDUCTASE
Deposited on 2007-04-06, released 2007-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GK1316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pg0a1, d2pg0a2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Geobacillus kaustophilus [TaxId:235909]
    Gene: GK1316
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pg0b1, d2pg0b2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pg0A (A:)
    glnhmtarylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwv
    dekygglnadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvt
    gelitaiamtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqa
    kpphrgisllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeegkgfyy
    lmeklqqerlvvaiaaqtaaevmfsltkqyvkqrtafgkrvsefqtvqfrlaemateial
    grtfvdrvieehmagkqivtevsmakwwitemakrvaaeamqlhggygymeeyeiarryr
    dipvsaiyagtnemmktiiarqldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg0A (A:)
    tarylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwvdekyg
    glnadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvtgelit
    aiamtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqakpphr
    gisllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeegkgfyylmekl
    qqerlvvaiaaqtaaevmfsltkqyvkqrtafgkrvsefqtvqfrlaemateialgrtfv
    drvieehmagkqivtevsmakwwitemakrvaaeamqlhggygymeeyeiarryrdipvs
    aiyagtnemmktiiarqldl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pg0B (B:)
    glnhmtarylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwv
    dekygglnadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvt
    gelitaiamtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqa
    kpphrgisllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeegkgfyy
    lmeklqqerlvvaiaaqtaaevmfsltkqyvkqrtafgkrvsefqtvqfrlaemateial
    grtfvdrvieehmagkqivtevsmakwwitemakrvaaeamqlhggygymeeyeiarryr
    dipvsaiyagtnemmktiiarqldl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pg0B (B:)
    rylreehhmfraafrkflekeayphyndwekrgiiprsfwakmgengflcpwvdekyggl
    nadfaysvvineelekvgsslvgiglhndivtpyiasygteeqkqkwlpkcvtgelitai
    amtepgagsdlanisttavkdgdyyivngqktfitngihadlivvacktdpqakpphrgi
    sllvverdtpgftrgrklekvglhaqdtaelffqdakvpaynllgeegkgfyylmeklqq
    erlvvaiaaqtaaevmfsltkqyvkqrtafgkrvsefqtvqfrlaemateialgrtfvdr
    vieehmagkqivtevsmakwwitemakrvaaeamqlhggygymeeyeiarryrdipvsai
    yagtnemmktiiarqld