PDB entry 2pfo

View 2pfo on RCSB PDB site
Description: DNA Polymerase lambda in complex with DNA and dUPNPP
Class: transferase, lyase/DNA
Keywords: DNA polymerase, DNA Repair, phosphoryl transfer reaction, manganese, transferase, lyase-DNA COMPLEX
Deposited on 2007-04-05, released 2007-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-334)
      • engineered (302)
    Domains in SCOPe 2.07: d2pfoa1, d2pfoa2, d2pfoa3
  • Chain 'D':
    Compound: Downstream Primer
  • Chain 'P':
    Compound: Primer
  • Chain 'T':
    Compound: Template
  • Heterogens: MG, MN, NA, DUP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pfoA (A:)
    maqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeac
    sipgigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsl
    edirsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrr
    gkatcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlp
    gpgrrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnt
    hgakvgpgrvlptptekdvfrllglpyrepaerdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pfoA (A:)
    nlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmaek
    iieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqaslttq
    qaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvli
    thpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrldii
    vvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgakvgpgrvlp
    tptekdvfrllglpyrepaerdw
    

  • Chain 'D':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.