PDB entry 2pe5

View 2pe5 on RCSB PDB site
Description: Crystal Structure of the Lac Repressor bound to ONPG in repressed state
Class: transcription/DNA
Keywords: Lac repressor, allosteric effectors, gene regulation, DNA-binding, Transcription, Transcription regulation, TRANSCRIPTION/DNA COMPLEX
Deposited on 2007-04-02, released 2008-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.236
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-End)
      • engineered (59)
    Domains in SCOPe 2.06: d2pe5a1, d2pe5a2
  • Chain 'B':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-329)
      • engineered (59)
    Domains in SCOPe 2.06: d2pe5b1, d2pe5b2
  • Chain 'C':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-End)
      • engineered (59)
    Domains in SCOPe 2.06: d2pe5c1, d2pe5c2
  • Chain 'D':
    Compound: DNA (5'-d(*dap*dap*dtp*dtp*dgp*dtp*dgp*dap*dgp*dcp*dgp*dcp*dtp*dcp*dap*dcp*dap*dap*dtp*dt)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*dap*dap*dtp*dtp*dgp*dtp*dgp*dap*dgp*dcp*dgp*dcp*dtp*dcp*dap*dcp*dap*dap*dtp*dt)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*dap*dap*dtp*dtp*dgp*dtp*dgp*dap*dgp*dcp*dgp*dcp*dtp*dcp*dap*dcp*dap*dap*dtp*dt)-3')
  • Heterogens: 145

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pe5A (A:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pe5A (A:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrktt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pe5B (B:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pe5C (C:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pe5C (C:)
    kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrktt
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.