PDB entry 2pda

View 2pda on RCSB PDB site
Description: crystal structure of the complex between pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus and pyruvate.
Deposited on 1998-11-10, released 1999-02-16
The last revision prior to the SCOP 1.57 freeze date was dated 1999-04-23, with a file datestamp of 1999-04-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.234
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pdaA (A:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pdaB (B:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk