PDB entry 2pce

View 2pce on RCSB PDB site
Description: Crystal structure of putative mandelate racemase/muconate lactonizing enzyme from Roseovarius nubinhibens ISM
Class: lyase
Keywords: STRUCTURAL GENOMICS, ENOLASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LYASE
Deposited on 2007-03-29, released 2007-04-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-24, with a file datestamp of 2012-10-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pcea1, d2pcea2, d2pcea3
  • Chain 'B':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pceb1, d2pceb2, d2pceb3
  • Chain 'C':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pcec1, d2pcec2, d2pcec3
  • Chain 'D':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pced1, d2pced2, d2pced3
  • Chain 'E':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pcee1, d2pcee2, d2pcee3
  • Chain 'F':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pcef1, d2pcef2, d2pcef3
  • Chain 'G':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pceg1, d2pceg2, d2pceg3
  • Chain 'H':
    Compound: putative mandelate racemase/muconate lactonizing enzyme
    Species: Roseovarius nubinhibens [TaxId:89187]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pceh1, d2pceh2, d2pceh3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2pceA (A:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceA (A:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2pceB (B:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceB (B:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidapldggasapsdpglglrvn
    rdalgtpvktf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2pceC (C:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceC (C:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2pceD (D:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceD (D:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2pceE (E:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceE (E:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2pceF (F:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceF (F:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhrafkghsikigaseaeggpaldaeri
    tacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarcal
    pllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdtvg
    sqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrvnr
    dalgtpvktf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2pceG (G:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceG (G:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2pceH (H:)
    mslkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyi
    aahaggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaag
    lplcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpald
    aeritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslra
    rcalpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvq
    dtvgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglgl
    rvnrdalgtpvktfgdpieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2pceH (H:)
    lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
    haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
    lcdmtggrvagpvpvissiggdtpeamrakvarhraqgfkghsikigaseaeggpaldae
    ritacladrqpgewyladanngltvehalrmlsllppgldivleapcaswaetkslrarc
    alpllldeliqtetdliaairddlcdgvglkvskqggitpmlrqraiaaaagmvmsvqdt
    vgsqisfaailhlaqstprhllrcaldtramttaelaeidaplrdggasapsdpglglrv
    nrdalgtpvktf