PDB entry 2pc0

View 2pc0 on RCSB PDB site
Description: Apo Wild-type HIV Protease in the open conformation
Class: hydrolase
Keywords: HIV protease, HYDROLASE
Deposited on 2007-03-29, released 2007-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot A3FH86 (0-98)
      • engineered (6)
    Domains in SCOPe 2.07: d2pc0a_
  • Heterogens: MG, PGR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pc0A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigctlnf