PDB entry 2paf

View 2paf on RCSB PDB site
Description: Crystal Structure of the Lactose Repressor bound to anti-inducer ONPF in induced state
Class: transcription
Keywords: Lac repressor, allosteric effectors, gene regulation, TRANSCRIPTION
Deposited on 2007-03-27, released 2007-06-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.199
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pafa1
  • Chain 'B':
    Compound: lactose operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: lacI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2pafb1
  • Heterogens: NPF

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pafA (A:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2pafB (B:)
    lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
    liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
    iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
    mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
    drllqlsqgqavkgnqllpvslvkrkttl