PDB entry 2p9l

View 2p9l on RCSB PDB site
Description: Crystal Structure of bovine Arp2/3 complex
Class: structural protein
Keywords: actin, WD repeat, complex, STRUCTURAL PROTEIN
Deposited on 2007-03-26, released 2007-05-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin-like protein 3
    Species: Bos taurus [TaxId:9913]
    Gene: ACTR3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2p9la1, d2p9la2
  • Chain 'B':
    Compound: actin-like protein 2
    Species: Bos taurus [TaxId:9913]
    Gene: ACTR2
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Actin-related protein 2/3 complex subunit 1B
    Species: Bos taurus [TaxId:9913]
    Gene: ARPC1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58CQ2 (Start-371)
      • conflict (57)
    Domains in SCOPe 2.01: d2p9lc_
  • Chain 'D':
    Compound: Actin-related protein 2/3 complex subunit 2
    Species: Bos taurus [TaxId:9913]
    Gene: ARPC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2p9ld1, d2p9ld2
  • Chain 'E':
    Compound: Actin-related protein 2/3 complex subunit 3
    Species: Bos taurus [TaxId:9913]
    Gene: ARPC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2p9le_
  • Chain 'F':
    Compound: Actin-related protein 2/3 complex subunit 4
    Species: Bos taurus [TaxId:9913]
    Gene: ARPC4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2p9lf_
  • Chain 'G':
    Compound: Actin-related protein 2/3 complex subunit 5
    Species: Bos taurus [TaxId:9913]
    Gene: ARPC5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3SYX9 (Start-150)
      • conflict (16)
      • conflict (27)
    Domains in SCOPe 2.01: d2p9lg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9lA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldf
    figdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntp
    enreytaeimfesfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipv
    aegyvigscikhipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvk
    efnkydtdgskwikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevv
    deviqncpidvrrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelsggrlkp
    kpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9lA (A:)
    agrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpty
    atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe
    sfnvpglyiavqavlalaaswtsqvgertltgtvidsgdgvthvipvaegyvigscikhi
    piagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvkefnkydtdgskwi
    kqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevvdeviqncpidvrr
    plyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelskpkpidvqvithhmqryav
    wfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p9lC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
    rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
    slesalkdlkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9lC (C:)
    ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
    pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
    icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
    ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
    setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsq
    isvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p9lD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpdaekkemktitgktfssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9lD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepptdaavgdnigyitfvlfprhtnasardntinlih
    tfrdylhyhikcskayihtrmraktsdflkvlnrarp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p9lE (E:)
    mpayhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyei
    kneadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakp
    ankqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsgpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9lE (E:)
    payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
    neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
    nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p9lF (F:)
    mtatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekek
    vliegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitn
    fhteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9lF (F:)
    atlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekvl
    iegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnfh
    teqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p9lG (G:)
    mskntvssarfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalk
    nppintksqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdn
    ssavllqwhekalaaggvgsivrvltarktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9lG (G:)
    arfrkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdr
    agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
    aggvgsivrvltarktv