PDB entry 2p9i

View 2p9i on RCSB PDB site
Description: Crystal Structure of bovine Arp2/3 Complex co-crystallized with ADP and crosslinked with gluteraldehyde
Class: structural protein
Keywords: complex, WD repeat, actin
Deposited on 2007-03-26, released 2007-05-29
The last revision prior to the SCOP 1.75 freeze date was dated 2007-05-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: actin-like protein 3
    Species: BOS TAURUS
    Gene: ACTR3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p9ia1, d2p9ia2
  • Chain 'B':
    Compound: Actin-like protein
  • Chain 'C':
    Compound: Actin-related protein 2/3 complex subunit 1B
    Species: BOS TAURUS
    Gene: ARPC1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q58CQ2 (Start-371)
      • conflict (57)
    Domains in SCOP 1.75: d2p9ic1
  • Chain 'D':
    Compound: Actin-related protein 2/3 complex subunit 2
    Species: BOS TAURUS
    Gene: ARPC2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p9id1, d2p9id2
  • Chain 'E':
    Compound: Actin-related protein 2/3 complex subunit 3
    Species: BOS TAURUS
    Gene: ARPC3
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p9ie1
  • Chain 'F':
    Compound: Actin-related protein 2/3 complex subunit 4
    Species: BOS TAURUS
    Gene: ARPC4
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2p9if1
  • Chain 'G':
    Compound: Actin-related protein 2/3 complex subunit 5
    Species: BOS TAURUS
    Gene: ARPC5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3SYX9 (Start-150)
      • conflict (16)
      • conflict (27)
    Domains in SCOP 1.75: d2p9ig1
  • Heterogens: CA, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p9iA (A:)
    magrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldf
    figdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntp
    enreytaeimfesfnvpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipv
    aegyvigscikhipiagrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvk
    efnkydtdgskwikqytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevv
    deviqncpidvrrplyknivlsggstmfrdfgrrlqrdlkrtvdarlklseelsggrlkp
    kpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeigpsicrhnpvfgvms
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9iA (A:)
    grlpacvvdcgtgytklgyagntepqfiipsciaikekgvddldffigdeaiekptyatk
    wpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfesfn
    vpglyiavqavlalaaswtsrqvgertltgtvidsgdgvthvipvaegyvigscikhipi
    agrdityfiqqllrdrevgippeqsletakavkerysyvcpdlvkefnkydtdgskwikq
    ytginaiskkefsidvgyerflgpeiffhpefanpdftqpisevvdeviqncpidvrrpl
    yknivlsggstmfrdfgrrlqrdlkrtvdarlklseelskpkpidvqvithhmqryavwf
    ggsmlastpefyqvchtkkdyeeigpsicrhnp
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p9iC (C:)
    mayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdw
    apdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvi
    sicyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerp
    aptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatl
    asetlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpkqssqrgltare
    rfqnldkkassegsaaagagldslhknsvsqisvlsggkakcsqfcttgmdggmsiwdvr
    slesalkdlkiv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9iC (C:)
    ayhsflvepischawnkdrtqiaicpnnhevhiyeksgnkwvqvhelkehngqvtgvdwa
    pdsnrivtcgtdrnayvwtlkgrtwkptlvilrinraarcvrwapnekkfavgsgsrvis
    icyfeqendwwvckhikkpirstvlsldwhpnsvllaagscdfkcrifsayikeveerpa
    ptpwgskmpfgelmfesssscgwvhgvcfsangsrvawvshdstvcladadkkmavatla
    setlpllavtfitesslvaaghdcfpvlftydsaagklsfggrldvpagldslhknsvsq
    isvlsggkakcsqfcttgmdggmsiwdvrslesalkdlkiv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p9iD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
    inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpdaekkemktitgktfssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9iD (D:)
    millevnnriieetlalkfenaaagnkpeavevtfadfdgvlyhisnpngdktkvmvsis
    lkfykelqahgadellkrvygsylvnpesgynvsllydlenlpaskdsivhqagmlkrnc
    fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
    fmqefkegrrashtapqvlfshreppleldaavgdnigyitfvlfprhtnasardntinl
    ihtfrdylhyhikcskayihtrmraktsdflkvlnrarpd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p9iE (E:)
    mpayhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyei
    kneadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakp
    ankqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsgpgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9iE (E:)
    payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
    neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
    nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p9iF (F:)
    mtatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekek
    vliegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitn
    fhteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9iF (F:)
    tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
    liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
    hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p9iG (G:)
    mskntvssarfrkvdvdeydenkfvdeddggdgqagpdegevdsclrqgnmtaalqaalk
    nppintksqavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdn
    ssavllqwhekalaaggvgsivrvltarktv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p9iG (G:)
    arfrkvdvdeydenkfvdedagpdegevdsclrqgnmtaalqaalknppintksqavkdr
    agsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekala
    aggvgsivrvltarktv