PDB entry 2p8c

View 2p8c on RCSB PDB site
Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579 complexed with N-succinyl Arg.
Class: lyase
Keywords: Enolase superfamily, prediction of function, N-succinyl amino acid racemase, LYASE
Deposited on 2007-03-22, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p8ca1, d2p8ca2
  • Heterogens: MG, SUG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p8cA (A:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr