PDB entry 2p88

View 2p88 on RCSB PDB site
Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579
Class: lyase
Keywords: Enolase superfamily, Prediction of function, N-succinyl amino acid racemase, LYASE
Deposited on 2007-03-22, released 2007-07-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88a1, d2p88a2
  • Chain 'B':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88b1, d2p88b2
  • Chain 'C':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88c1, d2p88c2
  • Chain 'D':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88d1, d2p88d2
  • Chain 'E':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88e1, d2p88e2
  • Chain 'F':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88f1, d2p88f2
  • Chain 'G':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88g1, d2p88g2
  • Chain 'H':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: BC_0371
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p88h1, d2p88h2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88A (A:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88B (B:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88C (C:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88D (D:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88E (E:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88F (F:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88G (G:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p88H (H:)
    mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
    stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
    qliggryheefpvthvlsiadpenmaeeaasmiqkgyqsfkmkvgtnvkedvkrieavre
    rvgndiairvdvnqgwknsantltalrslghlnidwieqpviaddidamahirsktdlpl
    mideglkssremrqiikleaadkvniklmkcggiypavklahqaemagiecqvgsmvess
    vassagfhvafskkiitsveltgplkftkdignlhydvpfirlnekpglgieinedtlqe
    ltvfqdivr