PDB entry 2p87

View 2p87 on RCSB PDB site
Description: Crystal structure of the C-terminal domain of C. elegans pre-mRNA splicing factor Prp8
Class: splicing
Keywords: alpha-beta, SPLICING
Deposited on 2007-03-21, released 2007-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.226
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-mRNA-splicing factor Prp8
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: prp-8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p87a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p87A (A:)
    tasfasrtewrvraisstnlhlrtqhiyvnsddvkdtgytyilpknilkkfitisdlrtq
    iagfmygvsppdnpqvkeircivlvpqtgshqqvnlptqlpdhellrdfeplgwmhtqpn
    elpqlspqdvtthaklltdniswdgektvmitcsftpgsvsltaykltpsgyewgkantd
    kgnnpkgympthyekvqmllsdrflgyfmvpsngvwnynfqgqrwspamkfdvclsnpke
    yyhedhrpvhfhnfkafddplgtgsadredafa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p87A (A:)
    srtewrvraisstnlhlrtqhiyvnsddvkdtgytyilpknilkkfitisdlrtqiagfm
    ygvsppdnpqvkeircivlvpqtgshqqvnlptqlpdhellrdfeplgwmhtqpnelpql
    spqdvtthaklltdniswdgektvmitcsftpgsvsltaykltpsgyewgkantdkgnnp
    kgympthyekvqmllsdrflgyfmvpsngvwnynfqgqrwspamkfdvclsnpkeyyhed
    hrpvhf