PDB entry 2p7j

View 2p7j on RCSB PDB site
Description: Crystal structure of the domain of putative sensory box/GGDEF family protein from Vibrio parahaemolyticus
Class: transcription
Keywords: Sensory box/GGDEF family protein, Structural genomics, MCSG, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, TRANSCRIPTION
Deposited on 2007-03-20, released 2007-05-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative sensory box/GGDEF family protein
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP0354
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87SR8
      • modified residue (67)
      • modified residue (155)
      • modified residue (224)
    Domains in SCOPe 2.02: d2p7ja1, d2p7ja2
  • Chain 'B':
    Compound: Putative sensory box/GGDEF family protein
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Gene: VP0354
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87SR8
      • modified residue (67)
      • modified residue (155)
      • modified residue (224)
    Domains in SCOPe 2.02: d2p7jb1, d2p7jb2
  • Heterogens: NA, SO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p7jA (A:)
    nqkyqallannventakealhqlaytgreynniqdqietisdllghsqslydylrepska
    nltilenmwssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfk
    yaqsldneqisawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssl
    lnyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagy
    sysgehliafssikfvsneplhliidlsneqlskratrdindliqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p7jA (A:)
    nnventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilenmw
    ssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldneq
    isawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssllnyspvrdf
    hielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagysysgehlia
    fssikfvsneplhliidlsneqlsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p7jB (B:)
    nqkyqallannventakealhqlaytgreynniqdqietisdllghsqslydylrepska
    nltilenmwssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfk
    yaqsldneqisawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssl
    lnyspvrdfhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagy
    sysgehliafssikfvsneplhliidlsneqlskratrdindliqes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p7jB (B:)
    annventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilenm
    wssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldne
    qisawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssllnyspvrd
    fhielvkhkgfyiaspdesrlygdiipersqfnfsnmypdiwprvvseqagysysgehli
    afssikfvsneplhliidlsneqlskratrdind