PDB entry 2p6u

View 2p6u on RCSB PDB site
Description: Apo structure of the Hel308 superfamily 2 helicase
Class: DNA binding protein
Keywords: archaeal Helicase, SF2 helicase, DNA repair, DNA binding protein
Deposited on 2007-03-19, released 2007-06-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.14 Å
R-factor: 0.23
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: afUHEL308 HELICASE
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P6U (0-End)
    Domains in SCOPe 2.06: d2p6ua1, d2p6ua2, d2p6ua3, d2p6ua4
  • Heterogens: PO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6uA (A:)
    mkveelaesissyavgilkeegieelfppqaeavekvfsgknlllamptaagktllaema
    mvreaikggkslyvvplralagekyesfkkwekiglrigistgdyesrdehlgdcdiivt
    tsekadslirnraswikavsclvvdeihlldsekrgatleilvtkmrrmnkalrviglsa
    tapnvteiaewldadyyvsdwrpvplvegvlcegtlelfdgafstsrrvkfeelveecva
    enggvlvfestrrgaektavklsaitakyveneglekaileenegemsrklaecvrkgaa
    fhhagllngqrrvvedafrrgnikvvvatptlaagvnlparrvivrslyrfdgyskrikv
    seykqmagragrpgmdergeaiiivgkrdreiavkryifgeperitsklgvethlrfhsl
    siicdgyaktleeledffadtfffkqneislsyelervvrqlenwgmvveaahlaptklg
    slvsrlyidpltgfifhdvlsrmelsdigalhlicrtpdmerltvrktdswveeeafrlr
    kelsyypsdfsveydwflsevktalclkdwieekdedeicakygiapgdlrrivetaewl
    snamnriaeevgntsvsglterikhgvkeellelvrirhigrvrarklynagirnaediv
    rhrekvasligrgiaervvegisvkslnpesaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6uA (A:)
    mkveelaesissyavgilfppqaeavekvfsgknlllamptaagktllaemamvreaikg
    gkslyvvplralagekyesfkkwekiglrigistgdyesrdehlgdcdiivttsekadsl
    irnraswikavsclvvdeihlldsekrgatleilvtkmrrmnkalrviglsatapnvtei
    aewldadyyvsdwrpvplvegvlcegtlelfdgafstsrrvkfeelveecvaenggvlvf
    estrrgaektavklsaitakyveneglekaileenegemsrklaecvrkgaafhhaglln
    gqrrvvedafrrgnikvvvatptlvnlparrvivrslyrfkrikvseykqmagragrpgm
    dergeaiiivgkrdreiavkryifgeperitsklgvethlrfhslsiicdgyaktleele
    dffadtfffkqneislsyelervvrqlenwgmvveaahlaptklgslvsrlyidpltgfi
    fhdvlsrmelsdigalhlicrtpdmerltvrktdswveeeafrlrkelsyypsdfsveyd
    wflsevktalclkdwieekdedeicakygiapgdlrrivetaewlsnamnriaeevgnts
    vsglterikhgvkeellelvrirhigrvrarklynagirnaedivrhrekvasligrgia
    ervvegisvks