PDB entry 2p6t

View 2p6t on RCSB PDB site
Description: CRYSTAL STRUCTURE OF TRANSCRIPTIONAL REGULATOR NMB0573 and L-LEUCINE COMPLEX FROM NEISSERIA MENINGITIDIS
Class: Transcription
Keywords: NMB0573, Transcriptional regulator, Lrp/AsnC-family, N. Meninigitidis, Structural Genomics, Structural and functional analysis of N. meninigitidis transcriptional regulators, Oxford Protein Production Facility, OPPF, Transcription
Deposited on 2007-03-19, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.239
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6ta1, d2p6ta2
  • Chain 'B':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6tb1, d2p6tb2
  • Chain 'C':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6tc1, d2p6tc2
  • Chain 'D':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6td1, d2p6td2
  • Chain 'E':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6te1, d2p6te2
  • Chain 'F':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6tf1, d2p6tf2
  • Chain 'G':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9 (2-End)
      • modified residue (2)
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6tg1, d2p6tg2
  • Chain 'H':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6th1, d2p6th2
  • Heterogens: CA, LEU, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6tA (A:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tA (A:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p6tB (B:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tB (B:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhllk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p6tC (C:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tC (C:)
    tldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspesv
    nlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfv
    ldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p6tD (D:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tD (D:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p6tE (E:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tE (E:)
    tldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspesv
    nlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfv
    ldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p6tF (F:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tF (F:)
    ltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspes
    vnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshf
    vldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p6tG (G:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tG (G:)
    mpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaalls
    pesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnaf
    shfvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2p6tH (H:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6tH (H:)
    tldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspesv
    nlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfv
    ldtllshhgvqdaqssfvlkeikhttslplnhll