PDB entry 2p6s

View 2p6s on RCSB PDB site
Description: Crystal Structure of Transcriptional Regulator NMB0573/L-Met Complex from Neisseria Meningitidis
Class: transcription
Keywords: NMB0573, Transcriptional regulator, Lrp/AsnC-family, Structural Genomics, Structural and functional analysis of N. meninigitidis transcriptional regulators, Oxford Protein Production Facility, OPPF, TRANSCRIPTION
Deposited on 2007-03-19, released 2007-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sa1, d2p6sa2
  • Chain 'B':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sb1, d2p6sb2
  • Chain 'C':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sc1, d2p6sc2
  • Chain 'D':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sd1, d2p6sd2
  • Chain 'E':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6se1, d2p6se2
  • Chain 'F':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sf1, d2p6sf2
  • Chain 'G':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9 (2-End)
      • modified residue (2)
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sg1, d2p6sg2
  • Chain 'H':
    Compound: Transcriptional regulator, LRP/AsnC family
    Species: Neisseria meningitidis [TaxId:122586]
    Gene: NMB0573
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K0L9
      • modified residue (118)
    Domains in SCOPe 2.06: d2p6sh1, d2p6sh2
  • Heterogens: CA, MET, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6sA (A:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sA (A:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p6sB (B:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sB (B:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p6sC (C:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sC (C:)
    tldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspesv
    nlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfv
    ldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p6sD (D:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sD (D:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2p6sE (E:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sE (E:)
    qltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspe
    svnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafsh
    fvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2p6sF (F:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sF (F:)
    tldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspesv
    nlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfv
    ldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2p6sG (G:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sG (G:)
    mpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaalls
    pesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnaf
    shfvldtllshhgvqdaqssfvlkeikhttslplnhll
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2p6sH (H:)
    gpmpqltldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaal
    lspesvnlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmn
    afshfvldtllshhgvqdaqssfvlkeikhttslplnhllke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6sH (H:)
    tldktdikilqvlqengrltnvelservalspspclrrlkqledagivrqyaallspesv
    nlglqafirvsirkakdaredfaasvrkwpevlscfaltgetdyllqafftdmnafshfv
    ldtllshhgvqdaqssfvlkeikhttslplnhll