PDB entry 2p6n

View 2p6n on RCSB PDB site
Description: Human DEAD-box RNA helicase DDX41, helicase domain
Class: hydrolase
Keywords: RNA, helicase, dead, structural genomics, structural genomics consortium, sgc, hydrolase
Deposited on 2007-03-19, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.246
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJV9
      • engineered (146)
    Domains in SCOPe 2.07: d2p6na_
  • Chain 'B':
    Compound: ATP-dependent RNA helicase DDX41
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX41, ABS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJV9
      • engineered (146)
    Domains in SCOPe 2.07: d2p6nb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p6nA (A:)
    mhhhhhhssgvdlgtenlyfqsmgaasldviqeveyvkeeakmvylleclqktpppvlif
    aekkadvdaiheylllkgveavaihggkdqeertkaieafregkkdvlvatdvaskgldf
    paiqhvinydmpeeienyvhrigrtgcsgntgiattfinkacdesvlmdlkallleakqk
    vppvlqvlhcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6nA (A:)
    ldviqeveyvkeeakmvylleclqktpppvlifaekkadvdaiheylllkgveavaihgg
    kdqeertkaieafregkkdvlvatdvaskgldfpaiqhvinydmpeeienyvhrigrtgc
    tgiattfinkacdesvlmdlkallleakqkvppvlqvlhc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p6nB (B:)
    mhhhhhhssgvdlgtenlyfqsmgaasldviqeveyvkeeakmvylleclqktpppvlif
    aekkadvdaiheylllkgveavaihggkdqeertkaieafregkkdvlvatdvaskgldf
    paiqhvinydmpeeienyvhrigrtgcsgntgiattfinkacdesvlmdlkallleakqk
    vppvlqvlhcg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p6nB (B:)
    ldviqeveyvkeeakmvylleclqktpppvlifaekkadvdaiheylllkgveavaihgg
    kdqeertkaieafregkkdvlvatdvaskgldfpaiqhvinydmpeeienyvhrigrtgc
    stgiattfinkacdesvlmdlkallleakqkvppvlqv