PDB entry 2p5y

View 2p5y on RCSB PDB site
Description: Crystal structure of Thermus thermophilus HB8 UDP-glucose 4-epimerase complex with NAD
Class: isomerase
Keywords: TTHA0591, STRUCTURAL GENOMICS, UDP-glucose 4-epimerase, Thermus thermophilus HB8, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN STRUCTURAL GENOMICS/PROTEOMICS INITIATIVE, RSGI, ISOMERASE
Deposited on 2007-03-16, released 2007-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucose 4-epimerase
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Gene: TTHA0591
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2p5ya_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2p5yA (A:)
mrvlvtggagfigshivedllarglevavldnlatgkrenvpkgvpffrvdlrdkegver
afrefrpthvshqaaqasvkvsvedpvldfevnllgglnlleacrqygveklvfastgga
iygevpegeraeetwpprpkspyaaskaafehylsvygqsyglkwvslrygnvygprqdp
hgeagvvaifaervlkglpvtlyarktpgdegcvrdyvyvgdvaeahalalfslegiynv
gtgeghttrevlmavaeaagkapevqpapprpgdlersvlsplklmahgwrpkvgfqegi
rltvdhfrgav