PDB entry 2p4y

View 2p4y on RCSB PDB site
Description: Crystal structure of human PPAR-gamma-ligand binding domain complexed with an indole-based modulator
Class: transcription
Keywords: NUCLEAR RECEPTOR, LIGAND BINDING DOMAIN, LBD, ALPHA HELIX SANDWICH, PPAR-HOMODIMER, SPPARgM, PARTIAL AGONIST, TRANSCRIPTION
Deposited on 2007-03-13, released 2008-01-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.232
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2p4ya_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2p4yb_
  • Heterogens: C03, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p4yA (A:)
    gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
    kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
    gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
    dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
    dlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4yA (A:)
    npesadlralakhlydsyiksfpltkakarailtkspfviydmnsirifqgcqfrsveav
    qeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtrefl
    kslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnl
    lqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiy
    kdly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p4yB (B:)
    gsqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmged
    kikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllky
    gvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleld
    dsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmt
    dlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4yB (B:)
    adlralakhlydsyiksfpltkakarailspfviydmnsairifqgcqfrsveavqeite
    yaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrk
    pfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqale
    lqlklnhpessqlfakllqkmtdlrqivtehvqllhpllqeiykdly