PDB entry 2p4q

View 2p4q on RCSB PDB site
Description: Crystal Structure Analysis of Gnd1 in Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: Rossmann Fold, OXIDOREDUCTASE
Deposited on 2007-03-12, released 2007-07-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase, decarboxylating 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GND1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2p4qa1, d2p4qa2
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p4qA (A:)
    mghhhhhhmsadfgliglavmgqnlilnaadhgftvcaynrtqskvdhflaneakgksii
    gatsiedfisklkrprkvmllvkagapvdalinqivpllekgdiiidggnshfpdsnrry
    eelkkkgilfvgsgvsggeegarygpslmpggseeawphiknifqsisaksdgepccewv
    gpagaghyvkmvhngieygdmqliceaydimkrlggftdkeisdvfakwnngvldsflve
    itrdilkfddvdgkplvekimdtagqkgtgkwtainaldlgmpvtligeavfarclsalk
    neriraskvlpgpevpkdavkdreqfvddleqalyaskiisyaqgfmlireaaatygwkl
    nnpaialmwrggciirsvflgqitkayreepdlenllfnkffadavtkaqsgwrksiala
    ttygiptpafstalsfydgyrserlpanllqaqrdyfgahtfrvlpecasdnlpvdkdih
    inwtghggnvssstyqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p4qA (A:)
    msadfgliglavmgqnlilnaadhgftvcaynrtqskvdhflaneakgksiigatsiedf
    isklkrprkvmllvkagapvdalinqivpllekgdiiidggnshfpdsnrryeelkkkgi
    lfvgsgvsggeegarygpslmpggseeawphiknifqsisaksdgepccewvgpagaghy
    vkmvhngieygdmqliceaydimkrlggftdkeisdvfakwnngvldsflveitrdilkf
    ddvdgkplvekimdtagqkgtgkwtainaldlgmpvtligeavfarclsalknerirask
    vlpgpevpkdavkdreqfvddleqalyaskiisyaqgfmlireaaatygwklnnpaialm
    wrggciirsvflgqitkayreepdlenllfnkffadavtkaqsgwrksialattygiptp
    afstalsfydgyrserlpanllqaqrdyfgahtfrvlpecasdnlpvdkdihinwt