PDB entry 2p4a

View 2p4a on RCSB PDB site
Description: X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
Class: hydrolase/immune system
Keywords: camelid single-domain antibody, vhh, cab-rn05, RNAse a, paratope, yeast surface display, hydrolase-immune system complex
Deposited on 2007-03-11, released 2007-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p4aa_
  • Chain 'B':
    Compound: antibody cab-rn05
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P4A (0-120)
    Domains in SCOPe 2.07: d2p4ab_
  • Chain 'C':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p4ac_
  • Chain 'D':
    Compound: antibody cab-rn05
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P4A (0-120)
    Domains in SCOPe 2.07: d2p4ad_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4aA (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4aB (B:)
    qvqlvesggglvqaggslrlscaasgypwtyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggdalvatrygrwgqgtqvtvs
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4aC (C:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p4aD (D:)
    qvqlvesggglvqaggslrlscaasgypwtyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggdalvatrygrwgqgtqvtvs
    s