PDB entry 2p46

View 2p46 on RCSB PDB site
Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: se5b-ortho-2 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
Class: hydrolase/immune system
Keywords: semet phasing, camelid single-domain antibody, vhh, cab-rn05, RNAse a, yeast surface display, hydrolase-immune system complex
Deposited on 2007-03-11, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p46a_
  • Chain 'B':
    Compound: antibody cab-rn05
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P46 (Start-122)
    Domains in SCOPe 2.07: d2p46b_
  • Chain 'C':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p46c_
  • Chain 'D':
    Compound: antibody cab-rn05
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 2P46 (Start-122)
    Domains in SCOPe 2.07: d2p46d_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2p46A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p46A (A:)
    etaaakferqhmdsstsaasssnycnqmmksrnltckpvntfvhesladvqavcsqknva
    ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2p46B (B:)
    gsqvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggt
    lyadsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p46B (B:)
    qvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2p46C (C:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p46C (C:)
    etaaakferqhmdsstsaasssnycnqmmksrnltckpvntfvhesladvqavcsqknva
    ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2p46D (D:)
    gsqvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggt
    lyadsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvt
    vss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2p46D (D:)
    qvqmvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggtly
    adsvkgrmtisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvtvs
    s