PDB entry 2p43

View 2p43 on RCSB PDB site
Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.65A resolution: SE3-mono-1 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
Class: hydrolase/immune system
Keywords: semet phasing, camelid single-domain antibody, vhh, cab-rn05, RNAse a, yeast surface display, hydrolase, hydrolase-immune system complex
Deposited on 2007-03-11, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.161
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease pancreatic
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2p43a_
  • Chain 'B':
    Compound: antibody cab-rn05
    Species: Camelus dromedarius [TaxId:9838]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2P43 (0-122)
    Domains in SCOPe 2.07: d2p43b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p43A (A:)
    ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
    knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2p43B (B:)
    gsqvqlvesggglvqaggslrlscaasgyaytyiymgwfrqapgkeregvaamdsggggt
    lyadsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtygqwgqgtqvt
    vss